Streptomyces niveus: BBN63_01145 Help Entry BBN63_01145       CDS       T04887                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snw  Streptomyces niveus Pathway snw00261   Monobactam biosynthesis snw01100   Metabolic pathways snw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBN63_01145  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snw01008]     BBN63_01145 Polyketide biosynthesis proteins [BR:snw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBN63_01145 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQU65074 UniProt:  A0A1U9QLB2 LinkDB All DBs Position 286276..286482 Genome browser AA seq 68 aa AA seqDB search MTNPFDDDNATFLVLVNDEGQHSLWPVFADVPGGWDIAQGESSRQESLEYIEKNWTDIRP RSLVAQYT NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaatcctttcgacgacgacaacgccaccttcctcgttctggtgaatgacgagggc cagcactcgctttggccggtattcgccgacgtgcccggcggctgggacatcgcacaaggt gagagcagccgccaggagtccctggagtacatcgagaagaactggacggacatccgcccc agaagcctggtggcgcagtacacctga

DBGET integrated database retrieval system