Streptomyces niveus: BBN63_30095 Help Entry BBN63_30095       CDS       T04887                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snw  Streptomyces niveus Pathway snw00261   Monobactam biosynthesis snw01100   Metabolic pathways snw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BBN63_30095  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snw01008]     BBN63_30095 Polyketide biosynthesis proteins [BR:snw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BBN63_30095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQU69808 UniProt:  A0A1U9QZW2 LinkDB All DBs Position complement(7009891..7010091) Genome browser AA seq 66 aa AA seqDB search MGIDDADTVFQVVTNEQDQYSIWFADRAVPAGWAANGPAGTKQECLKHIERVWTDMRPRS VRERSA NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgggtatcgacgacgccgacaccgtcttccaggtcgtcaccaacgagcaggaccagtac tcgatctggttcgccgaccgggcggtgcccgcgggctgggccgcgaacggtccggccggc acgaagcaggaatgcctcaagcacatcgagcgggtgtggaccgacatgcgtcctcgttcg gtccgcgaacgctccgcctga

DBGET integrated database retrieval system