Streptomyces nigra: DC008_26605 Help Entry DC008_26605       CDS       T05839                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism snz  Streptomyces nigra Pathway snz00261   Monobactam biosynthesis snz01100   Metabolic pathways snz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC008_26605  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snz01008]     DC008_26605 Polyketide biosynthesis proteins [BR:snz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC008_26605 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWE52912 UniProt:  A0A2S1IK88 LinkDB All DBs Position 5748543..5748734 Genome browser AA seq 63 aa AA seqDB search MNPFDDPEGRFLVLVNDEEQHSLWPSRLPVPPGWRLVHGEDSRQACLDHVARHWTDLRPL STR NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaaccccttcgacgatccggaaggccgattcctggtcctcgtcaacgacgaggaacag cactccctgtggccgagccgcctgcccgtgccgcccggctggcgcctcgtccacggcgag gacagccgccaggcgtgcctcgaccacgtcgcgcggcactggaccgacctgcgcccgctc agcactcgttga

DBGET integrated database retrieval system