Streptomyces nigra: DC008_26670 Help Entry DC008_26670       CDS       T05839                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism snz  Streptomyces nigra Pathway snz00261   Monobactam biosynthesis snz01100   Metabolic pathways snz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:snz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DC008_26670  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:snz01008]     DC008_26670 Polyketide biosynthesis proteins [BR:snz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DC008_26670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AWE52923 UniProt:  A0A2S1IJW9 LinkDB All DBs Position 5766316..5766534 Genome browser AA seq 72 aa AA seqDB search MSDTDETTGETYVIVRNGEEQYSIWRSDREVPAGWTTVGEPAAREACLARIGELWTDMRP ASLRAAMSGNAR NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcgacaccgacgagacgaccggcgagacgtatgtgatcgtgcgcaacggagaggag cagtactcgatctggcgttccgaccgcgaggtgccggccgggtggacgacggtcggtgaa ccggccgcccgcgaggcgtgcctggcccggatcggcgaactgtggaccgacatgcggccc gccagtctccgcgcggccatgagcgggaacgcccgatga

DBGET integrated database retrieval system