Streptomyces olivoreticuli: QZH56_04080 Help Entry QZH56_04080       CDS       T09517                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sov  Streptomyces olivoreticuli Pathway sov00261   Monobactam biosynthesis sov01100   Metabolic pathways sov01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sov00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QZH56_04080  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sov01008]     QZH56_04080 Polyketide biosynthesis proteins [BR:sov01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QZH56_04080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WKK24814 LinkDB All DBs Position complement(976891..977091) Genome browser AA seq 66 aa AA seqDB search MSDAPTNPFDGDGEFHALVNDEGRHSLWPGFAAVPDGWTVVHGPCERQTALDWIAEHWTD LAPAAR NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacccaccaaccccttcgacggcgacggagagttccacgccctcgtcaac gacgagggccggcacagcctgtggccggggttcgccgccgtgccggacggctggaccgtc gtccacggcccctgcgagcggcagaccgccctcgactggatcgccgagcactggaccgac ctggccccggcagcccggtga

DBGET integrated database retrieval system