Streptomyces pactum: B1H29_01745 Help Entry B1H29_01745       CDS       T07142                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spac  Streptomyces pactum Pathway spac00261   Monobactam biosynthesis spac01100   Metabolic pathways spac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spac00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B1H29_01745  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spac01008]     B1H29_01745 Polyketide biosynthesis proteins [BR:spac01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B1H29_01745 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQS65830 UniProt:  A0A1S6J256 LinkDB All DBs Position complement(408231..408443) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDADGRFLVLVNDEGQHSLWPSFAEVPGGWTIALEENSRAACLEFVEANWKDLR PRSLVESMDA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgccgacggccgtttcctcgtcctcgtgaacgacgag ggccagcactcgctctggccgtccttcgcggaggtgcccggagggtggacgatcgccctc gaggagaacagccgggccgcctgcctggagttcgtcgaggccaactggaaggacctgcgc ccccgttccctcgtcgagtccatggacgcctga

DBGET integrated database retrieval system