Streptomyces paludis: DVK44_09700 Help Entry DVK44_09700       CDS       T06964                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spad  Streptomyces paludis Pathway spad00261   Monobactam biosynthesis spad01100   Metabolic pathways spad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DVK44_09700  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spad01008]     DVK44_09700 Polyketide biosynthesis proteins [BR:spad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DVK44_09700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXG77929 UniProt:  A0A345HMK5 LinkDB All DBs Position complement(2269353..2269574) Genome browser AA seq 73 aa AA seqDB search MPNPFEDDSREYLALSNEEEQYSLWPQDTEVPVGWRVVYGPATRKEILDHIERSWTDMRP KSLRNAVAQGDSR NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgcccaatccattcgaggacgacagccgggagtatctggcgctgagtaatgaagaagag cagtattcgctctggccgcaggacaccgaggtccccgtcggctggcgcgtcgtgtacggg ccggccaccaggaaggagattcttgaccatatcgaacggtcatggacggatatgcggccg aaaagtctgcggaacgcagtcgcacaaggagactcccggtga

DBGET integrated database retrieval system