Streptomyces paludis: DVK44_32210 Help Entry DVK44_32210       CDS       T06964                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spad  Streptomyces paludis Pathway spad00261   Monobactam biosynthesis spad01100   Metabolic pathways spad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DVK44_32210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spad01008]     DVK44_32210 Polyketide biosynthesis proteins [BR:spad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DVK44_32210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXG83043 UniProt:  A0A345I269 LinkDB All DBs Position 7313766..7313978 Genome browser AA seq 70 aa AA seqDB search MTNPFEDQDATYLVLKNEEGQFSLWPTFVDVPDGWEPVFGEADRQACLDFIEETWTDMRP KSLIDAMNAG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgacgaacccttttgaggaccaggacgccacctacctcgtgctgaagaacgaggagggc cagttctcgctctggcccacctttgtcgatgtgccggacgggtgggagccggtcttcggg gaggccgaccgtcaggcatgcctcgacttcatcgaggagacatggacggacatgcgcccc aagagcctgatcgacgccatgaacgccggctga

DBGET integrated database retrieval system