Streptomyces paludis: DVK44_33450 Help Entry DVK44_33450       CDS       T06964                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spad  Streptomyces paludis Pathway spad00261   Monobactam biosynthesis spad01100   Metabolic pathways spad01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spad00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DVK44_33450  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spad01008]     DVK44_33450 Polyketide biosynthesis proteins [BR:spad01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DVK44_33450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXG81823 UniProt:  A0A345HYP9 LinkDB All DBs Position 7659026..7659235 Genome browser AA seq 69 aa AA seqDB search MNTNPFDDPEGRFLVLVNDEGQHSLWPSFAEVPGGWTVALTENTRDTCLHFVETHWTDLR PRSLRAPAD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaacaccaacccgttcgacgaccccgaaggccgcttcctcgtcctggtgaacgacgag ggacagcactcgctctggccgtccttcgccgaggtccccggcggatggacggtcgcgctc accgagaacacccgggacacctgcctgcacttcgtcgagacccactggaccgatctgcgc ccccggtccctcagggcccccgccgactga

DBGET integrated database retrieval system