Streptomyces parvulus: Spa2297_33095 Help Entry Spa2297_33095     CDS       T04685                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism spav  Streptomyces parvulus Pathway spav00261   Monobactam biosynthesis spav01100   Metabolic pathways spav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spav00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Spa2297_33095  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spav01008]     Spa2297_33095 Polyketide biosynthesis proteins [BR:spav01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Spa2297_33095 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANJ11943 UniProt:  A0A191VAN9 LinkDB All DBs Position pSPA1:319782..319997 Genome browser AA seq 71 aa AA seqDB search MSTNPFDDENGGFRVVVNDEEQHSLWPAFAEVPAGWRVVFGEAARSECLEYVERHWTDLR PRSLREAMAAD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaaccccttcgacgacgagaacggcggcttccgcgtagtcgtcaacgacgag gagcagcactcgctgtggccggccttcgccgaggtgcccgccggctggcgggtcgtcttc ggcgaggcggccaggtccgagtgcctggagtacgtcgagcggcactggaccgacctgcgg ccccggagcctgcgggaggccatggcggcggactga

DBGET integrated database retrieval system