Serratia proteamaculans: Spro_3428 Help Entry Spro_3428         CDS       T00595                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism spe  Serratia proteamaculans Pathway spe00261   Monobactam biosynthesis spe01100   Metabolic pathways spe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Spro_3428  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spe01008]     Spro_3428 Polyketide biosynthesis proteins [BR:spe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Spro_3428 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABV42526 UniProt:  A8GHD6 LinkDB All DBs Position complement(3796484..3796690) Genome browser AA seq 68 aa AA seqDB search METQNPFDDEQQICLIVCNDQLQYSLWPEFSAVPAGWTPVFGPAARPLCVLWLEQYWQDM RPASLRKA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggaaactcagaacccgttcgatgacgaacaacaaatttgcctgattgtgtgcaatgac caactgcagtacagcctgtggcccgaatttagcgcagtaccggcggggtggacgccggta ttcggcccggcggcgcggccgctgtgcgtgctgtggctggaacaatattggcaggatatg cggcccgcatcactgcgtaaggcgtga

DBGET integrated database retrieval system