Streptomyces peucetius subsp. caesius: CGZ69_27045 Help Entry CGZ69_27045       CDS       T07792                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism speu  Streptomyces peucetius subsp. caesius Pathway speu00261   Monobactam biosynthesis speu01100   Metabolic pathways speu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:speu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CGZ69_27045  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:speu01008]     CGZ69_27045 Polyketide biosynthesis proteins [BR:speu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CGZ69_27045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  ATW50981 LinkDB All DBs Position 5900779..5900994 Genome browser AA seq 71 aa AA seqDB search MATNPFENDDARYFVLVNEENQHSLWPAFAEVPAGWTVVHGEDSRQACLDHINENWTDMR PKSLAAAMDAA NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcgaccaaccccttcgagaacgacgacgcgcgctacttcgtcctcgtcaacgaggag aaccagcactccctctggcccgccttcgccgaggtgccggccggctggaccgtcgtccac ggcgaggacagccgccaggcctgcctcgaccacatcaacgagaactggaccgacatgcgg ccgaagtccctcgccgccgccatggacgccgcctga

DBGET integrated database retrieval system