Streptomyces phaeoluteigriseus: NFX46_19945 Help Entry NFX46_19945       CDS       T08568                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sphw  Streptomyces phaeoluteigriseus Pathway sphw00261   Monobactam biosynthesis sphw01100   Metabolic pathways sphw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NFX46_19945  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sphw01008]     NFX46_19945 Polyketide biosynthesis proteins [BR:sphw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NFX46_19945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH CNPase Motif Other DBs NCBI-ProteinID:  USQ85818 LinkDB All DBs Position 4522099..4522362 Genome browser AA seq 87 aa AA seqDB search MTPKPDDDDRQYKVVVNHEEQYSVWPADRDNPAGWSDAGRTGPKADCLAHIEDVWTDMRP LSLRRRLRASEQDGQDGPLAEGADRAG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgccgaagcccgacgatgacgaccggcagtacaaggtcgtggtcaaccatgaggag cagtactccgtctggcccgccgaccgggacaacccggcagggtggtcggacgcgggcagg accggcccgaaggccgactgcctcgctcatatcgaggacgtgtggaccgacatgcgtccg ctgagcctgcgccgtcgtctgcgggcgagcgaacaggacggacaggacggaccgttggcg gagggcgccgaccgggcgggctga

DBGET integrated database retrieval system