Streptomyces phaeoluteigriseus: NFX46_23380 Help Entry NFX46_23380       CDS       T08568                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sphw  Streptomyces phaeoluteigriseus Pathway sphw00261   Monobactam biosynthesis sphw01100   Metabolic pathways sphw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NFX46_23380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sphw01008]     NFX46_23380 Polyketide biosynthesis proteins [BR:sphw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NFX46_23380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  USQ86386 LinkDB All DBs Position complement(5246608..5246820) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDNDGRFLVLVNDEGQYSLWPSFAEVPGGWVIAFPENTREACLEYVESHWTDLR PRSLAATMDS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacaacgacggccgattcctggtcctggtgaacgacgaa ggccagtactccctctggccgtccttcgccgaagtccccgggggatgggtgatcgccttt cccgagaacacccgggaagcctgcctggaatacgtcgagtcgcactggacggatctgcgc ccccgttccctcgcggcgaccatggacagctga

DBGET integrated database retrieval system