Streptomyces phaeoluteigriseus: NFX46_36815 Help Entry NFX46_36815       CDS       T08568                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sphw  Streptomyces phaeoluteigriseus Pathway sphw00261   Monobactam biosynthesis sphw01100   Metabolic pathways sphw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sphw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NFX46_36815  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sphw01008]     NFX46_36815 Polyketide biosynthesis proteins [BR:sphw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NFX46_36815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  USQ88826 LinkDB All DBs Position complement(8349799..8350002) Genome browser AA seq 67 aa AA seqDB search MVNPFDDETGTFHVLVNEEGQHCLWPAFAQIPDGWKAVLSDTGRAEALDHIERNWTDLRP RSLAEAS NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggtaaatccgtttgacgacgagaccgggacattccatgtgctggtcaacgaggaaggc cagcactgcctgtggccggcgttcgcacagatacccgacggctggaaggccgtcctgtcc gacaccggccgggccgaggccctcgaccacatcgagcggaactggaccgacctgcggccc aggagcctcgccgaggcgagctga

DBGET integrated database retrieval system