Spirillospora sp. NBC_01491: OHA34_09690 Help Entry OHA34_09690       CDS       T09711                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spiq  Spirillospora sp. NBC_01491 Pathway spiq00261   Monobactam biosynthesis spiq01100   Metabolic pathways spiq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spiq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     OHA34_09690  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spiq01008]     OHA34_09690 Polyketide biosynthesis proteins [BR:spiq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     OHA34_09690 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WUU92042 LinkDB All DBs Position complement(2009201..2009410) Genome browser AA seq 69 aa AA seqDB search MTNPFEDPDGTYVVLTNDEGQHSLWPSFAEVPAGWTVAKTEDTRAACLEYVEANWTDMRP GSLIEAMGD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaggaccccgacggcacctacgtcgtgctcaccaacgacgagggc cagcactccctctggccgtccttcgccgaggtcccggccggctggacggtcgccaagacc gaggacacccgggccgcctgcctggagtacgtcgaggcgaactggaccgacatgcgcccc ggcagtctcatcgaggcgatgggtgactga

DBGET integrated database retrieval system