Streptomyces platensis: CP981_01750 Help Entry CP981_01750       CDS       T07341                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spla  Streptomyces platensis Pathway spla00261   Monobactam biosynthesis spla01100   Metabolic pathways spla01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spla00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP981_01750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spla01008]     CP981_01750 Polyketide biosynthesis proteins [BR:spla01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP981_01750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  QEV50556 LinkDB All DBs Position 388391..388609 Genome browser AA seq 72 aa AA seqDB search MSNSLDEPDGSFLVLMNHEAQYSLWPEFAEIPDGWTVALPKSDRQTCLDYIEQQWTDMRP KSLVNDMTRGAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaattccttggacgagccggacggctcattcctggtgttgatgaatcacgaggca cagtactcactgtggccggaattcgcagagattcccgacgggtggacggtcgcacttccg aagagcgaccggcagacctgcctggattacatcgaacagcaatggacggatatgcgtccg aagagcttggtgaacgacatgacaaggggtgcggcatga

DBGET integrated database retrieval system