Streptomyces pluripotens: LK06_003290 Help Entry LK06_003290       CDS       T04845                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism splu  Streptomyces pluripotens Pathway splu00261   Monobactam biosynthesis splu01100   Metabolic pathways splu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:splu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LK06_003290  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:splu01008]     LK06_003290 Polyketide biosynthesis proteins [BR:splu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LK06_003290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARP69129 UniProt:  A0A221NTS3 LinkDB All DBs Position complement(774411..774638) Genome browser AA seq 75 aa AA seqDB search MRRGQVFTNPFDDGQPGAFLVLVNHENQHSLWPAETPVPGGWAEVSRGARQECLDYVESH WTDMRPSGLIEAPPH NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtgagaaggggccaggtgttcaccaatccgtttgacgacggccagccgggggcattcctc gtacttgtcaatcatgagaatcagcactccctctggcccgccgagacgcctgttccgggc gggtgggcggaagtgagccggggcgcccggcaggagtgtctggattatgtcgagtcccat tggaccgatatgcgtccgtccgggctcatcgaagcaccgccacactga

DBGET integrated database retrieval system