Streptomyces pluripotens: LK06_020980 Help Entry LK06_020980       CDS       T04845                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism splu  Streptomyces pluripotens Pathway splu00261   Monobactam biosynthesis splu01100   Metabolic pathways splu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:splu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LK06_020980  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:splu01008]     LK06_020980 Polyketide biosynthesis proteins [BR:splu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LK06_020980 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ARP72015 UniProt:  A0A221P3A5 LinkDB All DBs Position 4674967..4675179 Genome browser AA seq 70 aa AA seqDB search MTNPFEDADGTYVVLVNDEGQHSLWPTFVDVPAGWLTAHPADTRDACLAYIEANWTDMRP RSLATAMDAQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgaggacgcggacggcacctatgtggtgctcgtcaacgacgaggga cagcactccctctggccgacgttcgtcgacgtgcccgccggctggctgaccgcccacccg gccgacacccgcgacgcctgcctcgcctacatcgaggccaactggaccgatatgcgcccg cgtagtctcgccaccgcgatggacgcgcagtaa

DBGET integrated database retrieval system