Serratia inhibens: Q5A_022380 Help Entry Q5A_022380        CDS       T04576                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism sply  Serratia inhibens Pathway sply00790   Folate biosynthesis sply01100   Metabolic pathways sply01240   Biosynthesis of cofactors Module sply_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:sply00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Q5A_022380 (folB) Enzymes [BR:sply01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Q5A_022380 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Q5A_022380 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Q5A_022380 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ANS44893 UniProt:  A0A1B1KWU8 LinkDB All DBs Position complement(4797667..4798026) Genome browser AA seq 119 aa AA seqDB search MDIVFIEELTVITTIGVYDWEQNIRQKLVFDIEMGWDNRQAAASDDVNDCLSYADISEAI IQHVEPNRFALVERVAEEISEILLQRFNSPWVRIKVSKPGAVAHASRVGVIIERGTRPV NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atggatatcgtatttattgaagagcttaccgttattaccaccattggcgtttatgattgg gaacaaaacattcgccagaagctggtgttcgatatcgaaatgggctgggacaaccgccag gccgcagccagcgacgacgtaaacgactgtcttagctatgccgatatcagcgaagccatc atccagcacgtggagccgaatcgtttcgcgttggtggagcgggtagcagaggaaatatct gaaattttactccagcgcttcaattccccgtgggtccgtattaaggtcagcaaaccgggc gcagttgcacacgccagccgggttggggtcattattgagcgtggcacccggccggtgtga

DBGET integrated database retrieval system