Sporosarcina sp. PTS2304: DV702_14105 Help Entry DV702_14105       CDS       T05572                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism spos  Sporosarcina sp. PTS2304 Pathway spos00790   Folate biosynthesis spos01100   Metabolic pathways spos01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:spos00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     DV702_14105 (folB) Enzymes [BR:spos01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      DV702_14105 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      DV702_14105 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      DV702_14105 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AXI00749 UniProt:  A0A345P0E0 LinkDB All DBs Position 2941167..2941535 Genome browser AA seq 122 aa AA seqDB search MDYIHLNDMEFYGYHGALPEENKLGQRFRLTVSLATDLAEAGQTDDLSKTMNYAEVYEMC KNIVEGEAVHLIETVAETVAGTIMTDFAEKVNGVRVVLIKPDPPIHGHYASVAVEITRGR FV NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggattatattcatttgaatgatatggagttttacggttaccacggtgcgctgccagaa gagaataaattaggacaacgtttccggttgacggtttcattggcgactgatcttgcggaa gcgggacaaacggatgatctttcaaaaacaatgaattatgccgaagtctatgagatgtgt aaaaacatcgtggaaggagaggccgttcatttaattgaaactgtcgcggaaacagtggca ggaacgattatgacagactttgccgaaaaggtgaatggtgtccgcgtcgtactgattaaa ccggacccgccgattcacggacattatgcgtctgtggcggttgaaattacaagggggcgc ttcgtgtga

DBGET integrated database retrieval system