Streptomyces prasinus: CP972_04255 Help Entry CP972_04255       CDS       T07676                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spra  Streptomyces prasinus Pathway spra00261   Monobactam biosynthesis spra01100   Metabolic pathways spra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spra00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP972_04255  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spra01008]     CP972_04255 Polyketide biosynthesis proteins [BR:spra01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP972_04255 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QEV04998 UniProt:  A0A5J6GW23 LinkDB All DBs Position complement(884832..885059) Genome browser AA seq 75 aa AA seqDB search MANPFDDESGTFLVLANDEGQHSLWPAFVEVPAGWTVVHPKDSRQACLDYVNTHWTDMRP KSLADEMDGAGSNVL NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtggctaaccccttcgatgacgagagcggtaccttccttgtgctcgccaacgacgaaggc cagcactcgctgtggccggcgttcgtggaggtgccggccggatggaccgtcgtccacccg aaggactcccggcaggcatgcctggactacgtcaacactcactggaccgacatgcgcccc aagagcctcgcggacgagatggacggcgccgggagcaacgtcttgtga

DBGET integrated database retrieval system