Streptomyces pristinaespiralis: SPRI_0188 Help Entry SPRI_0188         CDS       T04073                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism spri  Streptomyces pristinaespiralis Pathway spri00261   Monobactam biosynthesis spri01100   Metabolic pathways spri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SPRI_0188  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spri01008]     SPRI_0188 Polyketide biosynthesis proteins [BR:spri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SPRI_0188 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALC18494 UniProt:  D0RB82 LinkDB All DBs Position complement(221798..222016) Genome browser AA seq 72 aa AA seqDB search MSNPFEDAEGTFLVLVNHEGQYSLWPSFAEVPAGWTVALPATDRESALAHITDRWTDMRP QSLIDAMNGTAA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaaccccttcgaggacgccgagggcacctttctcgtcctggtcaaccacgagggc cagtactcgctctggccgtccttcgccgaggtcccggccggctggaccgtcgccctgccg gccaccgaccgcgagagcgccctggcccacatcaccgaccggtggaccgacatgcggccc cagagcctcatcgacgccatgaacggcacggcggcgtga

DBGET integrated database retrieval system