Salinivibrio proteolyticus: N7E60_04715 Help Entry N7E60_04715       CDS       T08723                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism spro  Salinivibrio proteolyticus Pathway spro00261   Monobactam biosynthesis spro01100   Metabolic pathways spro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N7E60_04715  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spro01008]     N7E60_04715 Polyketide biosynthesis proteins [BR:spro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N7E60_04715 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WBA15582 LinkDB All DBs Position 962633..962827 Genome browser AA seq 64 aa AA seqDB search MSEKYINPFDEPENQFFVLINHNNQYSLWPEFKGIPSGWKSTFGPSLKQDCIDYIETNWH DIRV NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgtctgagaaatatatcaatccttttgacgaacctgaaaaccagttctttgtgctgatt aatcacaacaatcaatatagcttatggcctgaattcaaagggatcccttctggctggaaa agcacatttggtccgtcattaaagcaagactgcattgattatatcgaaacgaattggcat gacattcgtgtgtga

DBGET integrated database retrieval system