Pseudosulfitobacter pseudonitzschiae: SULPSESMR1_00168 Help Entry SULPSESMR1_00168  CDS       T04974                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism spse  Pseudosulfitobacter pseudonitzschiae Pathway spse00261   Monobactam biosynthesis spse01100   Metabolic pathways spse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spse00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SULPSESMR1_00168  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spse01008]     SULPSESMR1_00168 Polyketide biosynthesis proteins [BR:spse01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SULPSESMR1_00168 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASM71006 UniProt:  A0A221JW88 LinkDB All DBs Position complement(182903..183106) Genome browser AA seq 67 aa AA seqDB search MTQPDLTQTLWRVLRNSEGRFSLLHANHPIPAGWSPVGDAAGRADCLDRIGALWTDMRPL SVQEALK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgacccagcctgacctgacacaaaccctctggcgcgtattgcgcaattccgaggggcgc ttttcactgctccacgccaatcacccgatccctgccggttggtcgcctgtgggcgatgcg gcgggccgcgccgactgtctagatcgcattggtgcactttggacagacatgcgccctcta tccgtacaagaggccctgaaatga

DBGET integrated database retrieval system