Streptomyces fodineus: BFF78_27210 Help Entry BFF78_27210       CDS       T05140                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism spun  Streptomyces fodineus Pathway spun00261   Monobactam biosynthesis spun01100   Metabolic pathways spun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:spun00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BFF78_27210  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:spun01008]     BFF78_27210 Polyketide biosynthesis proteins [BR:spun01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BFF78_27210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AOR34252 UniProt:  A0A1D7YFE4 LinkDB All DBs Position complement(6357052..6357264) Genome browser AA seq 70 aa AA seqDB search MSTNPFEDADHAYLVLVNPEGQHSLWPSFAEVPAGWTVALGESGRDAALQFVDEHWTDLR PHGVGAATGS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaacccgttcgaagacgcggaccacgcatacctggtgctggtcaaccccgaa ggccagcactcgctgtggccgtccttcgccgaggtgcccgccgggtggacggtggccctg ggcgagagcggccgggacgccgcgctgcagttcgtggacgagcactggacggacctgcgg ccgcacggcgtcggcgccgccacggggtcctga

DBGET integrated database retrieval system