Streptomyces qinzhouensis: FQU76_02695 Help Entry FQU76_02695       CDS       T06686                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sqz  Streptomyces qinzhouensis Pathway sqz00261   Monobactam biosynthesis sqz01100   Metabolic pathways sqz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sqz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FQU76_02695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sqz01008]     FQU76_02695 Polyketide biosynthesis proteins [BR:sqz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FQU76_02695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDY75596 UniProt:  A0A5B8J344 LinkDB All DBs Position 720640..720846 Genome browser AA seq 68 aa AA seqDB search MTNPFDDPEGSFHVVVNDEGQHALWPVFADIPAGWDGVWGPGSRTGALEYVAANWTDIRP KSLIAQYA NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgaccccgagggcagcttccacgtggtggtcaacgacgagggc cagcatgcgctgtggccggtcttcgcggacattcccgcaggctgggacggggtatggggg ccgggttcgaggaccggggcgctggagtacgtggcggcgaactggaccgacatccggccg aagagccttatcgcccagtacgcctga

DBGET integrated database retrieval system