Streptomyces qinzhouensis: FQU76_32870 Help Entry FQU76_32870       CDS       T06686                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sqz  Streptomyces qinzhouensis Pathway sqz00261   Monobactam biosynthesis sqz01100   Metabolic pathways sqz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sqz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FQU76_32870  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sqz01008]     FQU76_32870 Polyketide biosynthesis proteins [BR:sqz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FQU76_32870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDY80518 UniProt:  A0A5B8IPF0 LinkDB All DBs Position complement(7940771..7940986) Genome browser AA seq 71 aa AA seqDB search MPNPFEDPDASYLVLVNDEGRHALWPVFVMVPDGWRSVFGEAPRAECLEYIEKSWTDMRP QSPAEALGVSK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgccgaatcccttcgaggatcccgacgcgagctatctggttctggtcaacgatgaaggc cggcatgcgctctggccggtcttcgtgatggtgcccgacggctggagaagcgtcttcggc gaggcgccgcgggcggagtgcctggagtacatcgagaagtcctggaccgatatgcggccc cagagcccggccgaagccctgggcgtgagcaagtag

DBGET integrated database retrieval system