Streptomyces rapamycinicus: M271_00400 Help Entry M271_00400        CDS       T02907                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism src  Streptomyces rapamycinicus Pathway src00261   Monobactam biosynthesis src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M271_00400  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:src01008]     M271_00400 Polyketide biosynthesis proteins [BR:src01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M271_00400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGP51719 LinkDB All DBs Position complement(137122..137328) Genome browser AA seq 68 aa AA seqDB search MNPFDDPDAEFLVLVNDEGQHSLWPAFADVPGGWHVAHSKDSREACLAYIEENWTDMRPK SLIEAMGG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgaatcctttcgacgatcccgacgccgagttcttggtgctggtcaacgacgagggacag cattcgctgtggcccgccttcgcagacgtgcccggcggatggcatgtcgcccacagcaag gactcgcgtgaagcgtgcctggcctacatcgaggagaattggacggacatgcggcccaag agcctgatcgaggcgatgggcggctga

DBGET integrated database retrieval system