Streptomyces rapamycinicus: M271_09665 Help Entry M271_09665        CDS       T02907                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism src  Streptomyces rapamycinicus Pathway src00261   Monobactam biosynthesis src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M271_09665  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:src01008]     M271_09665 Polyketide biosynthesis proteins [BR:src01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M271_09665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH DUF2278 Motif Other DBs NCBI-ProteinID:  AGP53546 LinkDB All DBs Position complement(2490712..2490939) Genome browser AA seq 75 aa AA seqDB search MTNPFDNPDGTFLVLVNDEGQHSLWPAFAEVPAGWEVVVQETDRKTCLDYIETNWTDMRP KSLIEAMNRAEQSRG NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgacaacccagacggcaccttcctggttctggtcaatgacgagggc cagcactcgctgtggccggccttcgcggaggtcccggccggctgggaggtggtggtccag gagacggatcgcaagacctgcctggactacatcgagacgaactggaccgatatgcggccc aagagcctgatcgaggcgatgaaccgggctgagcagagccggggttga

DBGET integrated database retrieval system