Streptomyces rapamycinicus: M271_40600 Help Entry M271_40600        CDS       T02907                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism src  Streptomyces rapamycinicus Pathway src00261   Monobactam biosynthesis src01100   Metabolic pathways src01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:src00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M271_40600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:src01008]     M271_40600 Polyketide biosynthesis proteins [BR:src01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M271_40600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Melibiase_C Motif Other DBs NCBI-ProteinID:  AGP59499 LinkDB All DBs Position 10027508..10027717 Genome browser AA seq 69 aa AA seqDB search MSASPAARPDGDRYVVVVNHEEQYSVWFADRELPDGWTATGAQGTRQECLDHIEQVWTDL TPRSVRAAR NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgagcgcctcacccgccgcgcgccccgacggggaccggtacgtcgtcgtggtgaaccac gaggagcagtactcggtctggttcgccgaccgtgagctgcccgacggctggaccgccacc ggcgcgcagggcacccgccaggagtgcctggaccacatcgagcaggtgtggaccgacctg accccgcgctccgtacgagccgcacgatga

DBGET integrated database retrieval system