Serratia rhizosphaerae: FO014_17245 Help Entry FO014_17245       CDS       T07504                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srhz  Serratia rhizosphaerae Pathway srhz00261   Monobactam biosynthesis srhz01100   Metabolic pathways srhz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srhz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FO014_17245  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srhz01008]     FO014_17245 Polyketide biosynthesis proteins [BR:srhz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FO014_17245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QHA88580 UniProt:  A0A857EES1 LinkDB All DBs Position 3687463..3687672 Genome browser AA seq 69 aa AA seqDB search MDMPNPFDDPQQRCLILCNGQQQYSLWPDFSPAPDGWRTVFGPAERAECVGWLETHWRDM RPAAQREQQ NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggacatgccgaacccgtttgacgacccgcagcagcgctgcctgattctgtgcaacggg cagcagcagtacagcctgtggcctgacttcagtccggcaccggacggctggcgtacggtg ttcggcccggcagaacgcgccgaatgcgtcggctggctggaaacgcactggcgggacatg cggcccgccgcgcagcgtgagcaacaatga

DBGET integrated database retrieval system