Serratia rhizosphaerae: FO014_23400 Help Entry FO014_23400       CDS       T07504                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srhz  Serratia rhizosphaerae Pathway srhz00261   Monobactam biosynthesis srhz01100   Metabolic pathways srhz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srhz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FO014_23400  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srhz01008]     FO014_23400 Polyketide biosynthesis proteins [BR:srhz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FO014_23400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QHA89697 LinkDB All DBs Position complement(5000073..5000300) Genome browser AA seq 75 aa AA seqDB search MTQEQQNPFDDESLPFLVLINQQQQYSLWPQFAAVPAGWHEVMGPATRAECIAFIEAHWQ DMRPAALKNSVTPAP NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgactcaggaacaacaaaacccttttgatgatgaaagcctgccgtttttggtgctgatc aaccagcaacagcagtattcgctgtggccgcagtttgccgccgtgccggcaggctggcat gaggtgatggggccggcgacgcgcgccgagtgcatcgcgtttatcgaagcccattggcag gacatgcgccccgcggcgctgaaaaacagcgtaacgccggcgccgtaa

DBGET integrated database retrieval system