Streptomyces rimosus: CP984_26550 Help Entry CP984_26550       CDS       T07052                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srim  Streptomyces rimosus Pathway srim00261   Monobactam biosynthesis srim01100   Metabolic pathways srim01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srim00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CP984_26550  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srim01008]     CP984_26550 Polyketide biosynthesis proteins [BR:srim01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CP984_26550 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH APOC4 Motif Other DBs NCBI-ProteinID:  QEV78070 LinkDB All DBs Position 6122204..6122413 Genome browser AA seq 69 aa AA seqDB search MTNPFEDPEAQYHVLTNDENQHSLWPAFAEIPAGWQSVYGPEGRQACLDYVEEHWTDMRP RSLAEAMAD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgaagacccggaggcgcagtaccacgtcctgacgaacgacgagaac cagcactcgctgtggccggcgttcgcggagatcccggccggctggcagagcgtgtacggt ccggagggtcgtcaggcgtgcctggactacgtcgaggagcactggaccgacatgcggccc cgcagcctggcggaggccatggccgactga

DBGET integrated database retrieval system