Streptomyces rochei: SRO_0518 Help Entry SRO_0518          CDS       T06265                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srj  Streptomyces rochei Pathway srj00261   Monobactam biosynthesis srj01100   Metabolic pathways srj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SRO_0518  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srj01008]     SRO_0518 Polyketide biosynthesis proteins [BR:srj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SRO_0518 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBC91694 LinkDB All DBs Position 535037..535207 Genome browser AA seq 56 aa AA seqDB search MTNPFDDTDRSYVVLRNSLAEYSLWPVGITVPDGWEVVHEEDSRQACLSYIEEQAA NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgacacggaccgttcttacgtcgtcctgcgcaactccctcgcc gagtactccctttggcccgtcggcatcaccgtgcccgacggctgggaggtcgtccatgag gaggactcccggcaggcgtgcctgtcctacatcgaggagcaggcggcgtga

DBGET integrated database retrieval system