Streptomyces rochei: SRO_6307 Help Entry SRO_6307          CDS       T06265                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srj  Streptomyces rochei Pathway srj00261   Monobactam biosynthesis srj01100   Metabolic pathways srj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srj00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SRO_6307  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srj01008]     SRO_6307 Polyketide biosynthesis proteins [BR:srj01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SRO_6307 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BBC97483 LinkDB All DBs Position 6906230..6906427 Genome browser AA seq 65 aa AA seqDB search MSNPFEKEDGKYVVLRNEAGQHSMWPNFIEVPAGWTVVHGEDTRQSCLDYVERSWTDMKP LAPVE NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgtcgaacccctttgagaaggaagacggaaagtacgtcgtcctgcgcaacgaggctggg cagcactcgatgtggcccaacttcatcgaggtacccgccggttggacggtcgtgcacggc gaggacacccgccagagctgcctcgactacgtcgagcgctcctggaccgacatgaagccg ctcgccccggtcgagtaa

DBGET integrated database retrieval system