Streptomyces rectiverticillatus: FGW37_00505 Help Entry FGW37_00505       CDS       T06927                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srk  Streptomyces rectiverticillatus Pathway srk00261   Monobactam biosynthesis srk01100   Metabolic pathways srk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FGW37_00505  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srk01008]     FGW37_00505 Polyketide biosynthesis proteins [BR:srk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FGW37_00505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLE70293 LinkDB All DBs Position complement(105173..105418) Genome browser AA seq 81 aa AA seqDB search MVNNPFDDEDGIFHVLVNDEGQYSLWPVFADVPPGWSVVLADAARQVCLDYVNEHWTDMR PRSLAEAMKQGGAGAGHTGSE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ttggtgaacaatccgttcgatgatgaagacggcatctttcatgtactggtcaacgacgag gggcagtactccttgtggccggttttcgctgatgtacctcccggatggtccgtcgtgctc gccgatgccgcccggcaggtctgcctggactacgtgaacgaacactggacggacatgcgc cccaggagccttgccgaggccatgaagcaagggggagcgggagcggggcacaccggatct gaatga

DBGET integrated database retrieval system