Streptomyces rectiverticillatus: FGW37_27515 Help Entry FGW37_27515       CDS       T06927                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism srk  Streptomyces rectiverticillatus Pathway srk00261   Monobactam biosynthesis srk01100   Metabolic pathways srk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srk00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FGW37_27515  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srk01008]     FGW37_27515 Polyketide biosynthesis proteins [BR:srk01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FGW37_27515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLE74840 LinkDB All DBs Position 6276937..6277140 Genome browser AA seq 67 aa AA seqDB search MSDAPANPFDGEGPFLVLVNAEGRHSLWPGFAAVPDGWTTVHGPCERQQAVDWITENWTD LAPAAQG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgcacccgccaaccccttcgacggcgaaggcccgttcctcgtcctcgtgaac gccgagggccggcacagcctctggccgggtttcgccgccgtgccggacggctggacgacc gtccacggcccctgcgagcggcagcaggccgtggactggatcaccgagaactggaccgac ctggccccggcggcccaggggtga

DBGET integrated database retrieval system