Streptomyces rubrolavendulae: A4G23_05333 Help Entry A4G23_05333       CDS       T04616                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism srn  Streptomyces rubrolavendulae Pathway srn00261   Monobactam biosynthesis srn01100   Metabolic pathways srn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     A4G23_05333  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srn01008]     A4G23_05333 Polyketide biosynthesis proteins [BR:srn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     A4G23_05333 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Dioxygenase_C Motif Other DBs NCBI-ProteinID:  AOT62435 UniProt:  A0A1D8GAF4 LinkDB All DBs Position 6312059..6312277 Genome browser AA seq 72 aa AA seqDB search MSDSEQYRAEEYQVVLNDEEQYSVWRTDRPLPAGWRAEGTTGSRQECLDHIGRVWTDMRP LSLRRHLEPAGA NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcgacagcgagcagtaccgggccgaggagtaccaggtcgtcctcaacgacgaggag cagtactccgtctggcggaccgaccgcccgctgccggcgggctggcgcgccgagggcacg accgggtcgcgccaggagtgcctggaccacatcggccgcgtctggaccgacatgcgcccc ctgagcctgcgccgccacctggagccggccggcgcctga

DBGET integrated database retrieval system