Streptosporangium roseum: Sros_2200 Help Entry Sros_2200         CDS       T01137                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_2200  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_2200 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_2200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ85183 UniProt:  D2AY12 LinkDB All DBs Position complement(2366650..2366832) Genome browser AA seq 60 aa AA seqDB search MSHRVVVNHEEQYSIWPTGRDLPDGWREEGASGTRQECLVHIDQVWTDMRPLSAREATGV NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atgagtcaccgtgtcgtggtcaaccacgaggagcagtattcgatctggcccaccggccgg gatctgccggacggctggcgggaggagggcgcctccgggaccaggcaggagtgcctggtc cacatcgaccaggtctggaccgacatgcgcccgctcagcgccagggaggccacaggtgtc tga

DBGET integrated database retrieval system