Streptosporangium roseum: Sros_2422 Help Entry Sros_2422         CDS       T01137                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_2422  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_2422 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_2422 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ85400 UniProt:  D2B1D5 LinkDB All DBs Position complement(2627680..2627883) Genome browser AA seq 67 aa AA seqDB search MNKAGTMTDHPYLVVRNDEEQYSIWPAGRNLPAGWHEAGFSGAKQECLDHIETVWTDMRP LSLRQGG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaacaaggcaggaaccatgaccgaccacccctatctggtcgtgcgtaacgacgaggag cagtactcgatctggccggcggggcggaacctccccgccgggtggcacgaggccggcttc agcggagccaagcaggagtgcctggaccacatcgagacggtgtggaccgacatgcgcccc ctcagcctgcgtcagggcgggtga

DBGET integrated database retrieval system