Streptosporangium roseum: Sros_3469 Help Entry Sros_3469         CDS       T01137                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_3469  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_3469 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_3469 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ86405 UniProt:  D2BF44 LinkDB All DBs Position 3837006..3837206 Genome browser AA seq 66 aa AA seqDB search MSNPFDDPEGVYTVLVNDEGQHSLWPEFAEVPEGWTVAHGPGTRQECLEHIEANWTDMRP KSLIES NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgacgaccccgagggcgtctacaccgtcctggtcaacgatgaggga cagcacagtctgtggcccgagttcgcggaggtcccggaggggtggaccgtcgcccacggt ccgggcacccgccaggagtgcctggagcacatcgaggccaactggaccgacatgcgcccg aagagcctcatcgagtcgtag

DBGET integrated database retrieval system