Streptosporangium roseum: Sros_5581 Help Entry Sros_5581         CDS       T01137                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_5581  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_5581 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_5581 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ88333 UniProt:  D2BFH5 LinkDB All DBs Position 6103129..6103329 Genome browser AA seq 66 aa AA seqDB search MSNPFEDENAHFFVLVNTEGQHSLWPVSIDVPHGWNVVHGEDTRQGCLDFTDANWTDMRP RSLSTS NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccgttcgaggatgaaaacgcccattttttcgtcctcgtgaacaccgagggc cagcactctctctggcccgtgtccatcgacgttccccacggctggaacgtcgtgcacgga gaggacacccggcaggggtgcctcgacttcaccgatgcgaactggacggatatgcgtccc cgcagcctctccacctcctga

DBGET integrated database retrieval system