Streptosporangium roseum: Sros_6841 Help Entry Sros_6841         CDS       T01137                                  Name (GenBank) MbtH domain-containing protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_6841  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_6841 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_6841 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ89547 UniProt:  D2B722 LinkDB All DBs Position complement(7533324..7533503) Genome browser AA seq 59 aa AA seqDB search MSFLVVLNDEEQYSVWPGGRELPAGWRAEGFQGPREDCLAHIDQVWTDMRPLSVRQARA NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgagttttctggtggtgctcaacgacgaggagcagtactccgtctggcccggcggccgg gagctgcccgccggatggcgggccgagggcttccaggggcccagggaggactgcctggcc cacatcgaccaggtgtggacggacatgcgcccgctcagtgtgcggcaggcacgggcgtga

DBGET integrated database retrieval system