Streptosporangium roseum: Sros_6969 Help Entry Sros_6969         CDS       T01137                                  Name (GenBank) conserved hypothetical protein   KO K05375   MbtH protein Organism sro  Streptosporangium roseum Pathway sro00261   Monobactam biosynthesis sro01100   Metabolic pathways sro01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sro00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Sros_6969  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sro01008]     Sros_6969 Polyketide biosynthesis proteins [BR:sro01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Sros_6969 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACZ89670 UniProt:  D2B8R4 LinkDB All DBs Position 7682634..7682849 Genome browser AA seq 71 aa AA seqDB search MTNPFDLQDGVYSVLINEEGQHSLWPASADAPAGWAVAYGPARRGACVDYVNSNWTDMRP RSLAARMGASS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccttttgacctccaggacggtgtttactccgtgctgatcaacgaggagggc cagcactccctgtggccggcctccgccgacgcgccggcgggatgggccgtcgcgtacggc ccggcccgccgcggcgcctgcgtcgactacgtgaactccaactggaccgacatgcggccg cgcagcctcgcggcccgcatgggcgcctcctcctga

DBGET integrated database retrieval system