Streptomyces roseicoloratus: RGF97_32600 Help Entry RGF97_32600       CDS       T09671                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sroc  Streptomyces roseicoloratus Pathway sroc00261   Monobactam biosynthesis sroc01100   Metabolic pathways sroc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sroc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RGF97_32600  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sroc01008]     RGF97_32600 Polyketide biosynthesis proteins [BR:sroc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RGF97_32600 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WMX48593 UniProt:  A0AA51VZK3 LinkDB All DBs Position 7195661..7195873 Genome browser AA seq 70 aa AA seqDB search MSNPFEDDNAGYLVLVNDENQHSLWPVWIDVPAGWTTVHGEAPRQECLDWIEANWTDIRP ASLLATLDQR NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaacccgttcgaggacgacaacgccggctacctggtcctggtcaacgacgagaac cagcactcgctctggccggtctggatcgacgtgcccgccggctggaccaccgtccacggc gaggccccgcgccaggagtgcctggactggatcgaggccaactggaccgacatccgcccc gcgagcctgctcgccaccctcgaccagcggtga

DBGET integrated database retrieval system