Streptomyces roseirectus: IAG44_04220 Help Entry IAG44_04220       CDS       T07860                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sroi  Streptomyces roseirectus Pathway sroi00261   Monobactam biosynthesis sroi01100   Metabolic pathways sroi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sroi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IAG44_04220  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sroi01008]     IAG44_04220 Polyketide biosynthesis proteins [BR:sroi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IAG44_04220 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QNP68741 UniProt:  A0A7H0I7H5 LinkDB All DBs Position complement(1054123..1054323) Genome browser AA seq 66 aa AA seqDB search MSTNPFDDAEGRFLVLVNDEGQHSLWPSFAEVPGGWTVAFGEDTRDACLAYVEANWTDLR PRSLAG NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgagcacgaacccgttcgacgacgccgaaggccgtttcctggtcctggtgaacgacgag ggccagcactccctgtggccgtcgttcgcggaggtccccggcggctggacggtggcgttc ggcgaggacacccgcgacgcctgcctggcctacgtcgaggccaactggacggacctgcgc ccgcgttcactggccggctga

DBGET integrated database retrieval system