Segniliparus rotundus: Srot_0737 Help Entry Srot_0737         CDS       T01238                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism srt  Segniliparus rotundus Pathway srt00261   Monobactam biosynthesis srt01100   Metabolic pathways srt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:srt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Srot_0737  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:srt01008]     Srot_0737 Polyketide biosynthesis proteins [BR:srt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Srot_0737 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADG97217 UniProt:  D6ZDF3 LinkDB All DBs Position complement(724028..724264) Genome browser AA seq 78 aa AA seqDB search MPTNPFDDEQGRFFVLINDEEQRSLWPVFAAVPAGWTIEHGAPDGDSRQACLDFVESAWT DLRPRSLRVAMAGAANGA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgccgacaaatcccttcgacgacgagcaaggccgtttcttcgtcctcatcaacgacgaa gagcagcgcagcctgtggccagtgttcgcggccgttcctgccggttggacgatcgaacac ggagctccggacggcgattcccgtcaagcgtgcctggatttcgtcgagagcgcatggacg gacttgcgcccgcgcagcctgcgcgtcgccatggccggagccgccaatggcgcctag

DBGET integrated database retrieval system