Sinocyclocheilus rhinocerous: 107742054 Help Entry 107742054         CDS       T04916                                  Name (RefSeq) ras-like protein isoform X1   KO K07827   GTPase KRas Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04012   ErbB signaling pathway srx04068   FoxO signaling pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04150   mTOR signaling pathway srx04210   Apoptosis srx04218   Cellular senescence srx04370   VEGF signaling pathway srx04371   Apelin signaling pathway srx04540   Gap junction srx04625   C-type lectin receptor signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04914   Progesterone-mediated oocyte maturation srx04916   Melanogenesis Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107742054    04012 ErbB signaling pathway     107742054    04370 VEGF signaling pathway     107742054    04371 Apelin signaling pathway     107742054    04068 FoxO signaling pathway     107742054    04150 mTOR signaling pathway     107742054  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107742054    04137 Mitophagy - animal     107742054   09143 Cell growth and death    04210 Apoptosis     107742054    04218 Cellular senescence     107742054   09144 Cellular community - eukaryotes    04540 Gap junction     107742054   09142 Cell motility    04810 Regulation of actin cytoskeleton     107742054  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107742054   09152 Endocrine system    04910 Insulin signaling pathway     107742054    04912 GnRH signaling pathway     107742054    04914 Progesterone-mediated oocyte maturation     107742054    04916 Melanogenesis     107742054  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107742054   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:srx04031]     107742054 Membrane trafficking [BR:srx04131]  Endocytosis   Macropinocytosis    Ras GTPases     107742054 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107742054 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  107742054 NCBI-ProteinID:  XP_016410390 UniProt:  A0A673I773 LinkDB All DBs Position Unknown AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRSVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLRKLSKEEKTTQC IKLKKCVLM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagcttgtggtcgtgggggctggaggcgtgggcaagagcgctctcacc atccaactcatccagaaccactttgtggatgaatacgacccaaccatagaggactcctac agaaagcaggtggtgattgacggggagacgtgtctgctggacatcttggacactgcaggt caggaggagtacagcgccatgagggatcagtacatgaggacaggagagggcttcctctgt gtcttcgccatcaataacaccaagtcctttgaggacattcaccactacagagagcagata aaacgagtaaaggactctgaggatgtccccatggtcctggtggggaataagtgtgatctt ccatcccgcagtgtggacaccaagcaggctcaggatttagcacgtagctacggcatccca tttatagagacctcagcaaagacgagacagagagtggaagatgccttttatactctggta cgggaaatcaggcaataccggctgagaaaactcagtaaagaagaaaagacgacacaatgc atcaagcttaaaaaatgtgttttgatgtga

DBGET integrated database retrieval system