Sinocyclocheilus rhinocerous: 107754174 Help Entry 107754174         CDS       T04916                                  Name (RefSeq) GTPase HRas-like   KO K07827   GTPase KRas Organism srx  Sinocyclocheilus rhinocerous Pathway srx04010   MAPK signaling pathway srx04012   ErbB signaling pathway srx04068   FoxO signaling pathway srx04137   Mitophagy - animal srx04140   Autophagy - animal srx04150   mTOR signaling pathway srx04210   Apoptosis srx04218   Cellular senescence srx04370   VEGF signaling pathway srx04371   Apelin signaling pathway srx04540   Gap junction srx04625   C-type lectin receptor signaling pathway srx04810   Regulation of actin cytoskeleton srx04910   Insulin signaling pathway srx04912   GnRH signaling pathway srx04914   Progesterone-mediated oocyte maturation srx04916   Melanogenesis Brite KEGG Orthology (KO) [BR:srx00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     107754174    04012 ErbB signaling pathway     107754174    04370 VEGF signaling pathway     107754174    04371 Apelin signaling pathway     107754174    04068 FoxO signaling pathway     107754174    04150 mTOR signaling pathway     107754174  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     107754174    04137 Mitophagy - animal     107754174   09143 Cell growth and death    04210 Apoptosis     107754174    04218 Cellular senescence     107754174   09144 Cellular community - eukaryotes    04540 Gap junction     107754174   09142 Cell motility    04810 Regulation of actin cytoskeleton     107754174  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     107754174   09152 Endocrine system    04910 Insulin signaling pathway     107754174    04912 GnRH signaling pathway     107754174    04914 Progesterone-mediated oocyte maturation     107754174    04916 Melanogenesis     107754174  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:srx04131]     107754174   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:srx04031]     107754174 Membrane trafficking [BR:srx04131]  Endocytosis   Macropinocytosis    Ras GTPases     107754174 GTP-binding proteins [BR:srx04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     107754174 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N G-alpha ATP_bind_1 AAA_22 Septin AAA_14 Motif Other DBs NCBI-GeneID:  107754174 NCBI-ProteinID:  XP_016426026 UniProt:  A0A673GML9 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSDL ASRTVETRQAQELARSYGVPFVETSAKTRQGVEEAFYSLVREIRRYKETNRSNKKSKKHT QRRCTLL NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtagttgtcggggctggtggcgttgggaaaagtgctctgacc atccagctcattcagaatcactttgtagacgagtatgaccccactattgaggattcttac agaaagcaggttgtgattgacggagagacgtgtttgctggacatcctggacaccgctggt caggaggagtacagtgccatgagagatcagtatatgaggacaggagagggctttctgtgt gtgtttgccatcaacaacgccaagtcctttgaggacgtacatctttacagggagcaaata aaccgtgtcaaagacagcgacaatgtcccgatggtgctggtggggaacaaaagtgacctg gcctctcgtactgtagagacgcgtcaagcccaagagctcgccagaagttacggggtccca tttgtcgaaacatctgccaagacgcgacagggagttgaggaggcattttactctctcgtg cgggagatccgaagatacaaggagacaaaccgcagcaataagaagagcaaaaagcacaca cagagacgctgcactcttttatag

DBGET integrated database retrieval system